Rabbit MKNK2 antibody
-
Catalog number70R-5832
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenMKNK2 antibody was raised using the N terminal of MKNK2 corresponding to a region with amino acids SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL
-
SpecificityMKNK2 antibody was raised against the N terminal of MKNK2
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MKNK2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolMKNK2
-
Short nameRabbit MKNK2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal MKNK2 antibody raised against the N terminal of MKNK2
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetMAP kinase interacting serine/threonine kinase 2, GPRK7 and MNK2, MKNK2 and IDBG-15316 and ENSG00000099875 and 2872, transferase activity, nuclei, Mknk2 and IDBG-175279 and ENSMUSG00000020190 and 17347, MKNK2 and IDBG-644643 and ENSBTAG00000018049 and 538519
-
Gene info
-
Identity
-
Gene
-
Long gene nameMAPK interacting serine/threonine kinase 2
-
Synonyms gene
-
Synonyms gene name
- G protein-coupled receptor kinase 7
- MAP kinase interacting serine/threonine kinase 2
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2000-02-29
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- MAPK activated protein kinases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data