Rabbit MFAP4 antibody
-
Catalog number70R-6069
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenMFAP4 antibody was raised using the N terminal of MFAP4 corresponding to a region with amino acids TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK
-
SpecificityMFAP4 antibody was raised against the N terminal of MFAP4
-
Cross ReactivityHuman,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MFAP4 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolMFAP4
-
Short nameRabbit MFAP4 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal MFAP4 antibody raised against the N terminal of MFAP4
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetmicrofibrillar-associated protein 4, MFAP4 and IDBG-34759 and ENSG00000166482 and 4239, protein binding, Extracellular, Mfap4 and IDBG-183000 and ENSMUSG00000042436 and 76293, MFAP4 and IDBG-637769 and ENSBTAG00000006187 and 286766
-
Gene info
-
Identity
-
Gene
-
Long gene namemicrofibril associated protein 4
-
Synonyms gene name
- microfibrillar associated protein 4
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1994-11-17
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Fibrinogen C domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data