Rabbit MCM8 antibody
-
Catalog number70R-1607
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenMCM8 antibody was raised using the N terminal of MCM8 corresponding to a region with amino acids ELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPH
-
SpecificityMCM8 antibody was raised against the N terminal of MCM8
-
Cross ReactivityHuman,Mouse
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MCM8 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolMCM8-AS1, MCM8
-
Short nameRabbit MCM8 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal MCM8 antibody raised against the N terminal of MCM8
-
Alternative techniqueantibodies, rabbit-anti
-
Gene info
-
Identity
-
Gene
-
Long gene nameMCM8 antisense RNA 1
-
GenBank acession
-
Locus
-
Discovery year2014-08-08
-
Entrez gene record
-
RefSeq identity
-
Classification
- Antisense RNAs
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameminichromosome maintenance 8 homologous recombination repair factor
-
Synonyms gene
-
Synonyms gene name
- chromosome 20 open reading frame 154
- minichromosome maintenance complex component 8
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2001-07-17
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- MCM family
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data