Rabbit MCM3 antibody

  • Catalog number
    70R-5515
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB, IHC
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    DNA & RNA
  • Immunogen
    MCM3 antibody was raised using the C terminal of MCM3 corresponding to a region with amino acids SQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQE
  • Specificity
    MCM3 antibody was raised against the C terminal of MCM3
  • Cross Reactivity
    Human
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MCM3 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    MCM3  
  • Gene symbol
    MCM3
  • Short name
    Rabbit MCM3 antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal MCM3 antibody raised against the C terminal of MCM3
  • Alternative technique
    antibodies, rabbit-anti
Gene info
  • Identity
  • Gene
  • Long gene name
    minichromosome maintenance complex component 3
  • Synonyms gene name
    • minichromosome maintenance deficient (S. cerevisiae) 3
    • MCM3 minichromosome maintenance deficient 3 (S. cerevisiae)
  • GenBank acession
  • Locus
  • Discovery year
    1994-12-13
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • minichromosome maintenance 2-7 complex
    • MCM family
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee