Rabbit MASP2 antibody

• Catalog number
  70R-5919
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  MASP2 antibody was raised using the N terminal of MASP2 corresponding to a region with amino acids FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK
• Specificity
  MASP2 antibody was raised against the N terminal of MASP2
• Cross Reactivity
  Human,Mouse
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MASP2 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  MASP2  
• Gene symbol
  MASP2
• Short name
  Rabbit MASP2 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal MASP2 antibody raised against the N terminal of MASP2
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  mannan-binding lectin serine peptidase 2, MAP19 and MASP-2 and MASP1P1 and sMAP, MASP2 and IDBG-89176 and ENSG00000009724 and 10747, calcium-dependent protein binding, Extracellular, Masp2 and IDBG-204703 and ENSMUSG00000028979 and 17175, MASP2 and IDBG-633071 and ENSBTAG00000012808 and 505819

Gene info

• Identity
  HGNC:6902
• Gene
  MASP2
• Long gene name
  MBL associated serine protease 2
• Synonyms gene
  • MASP1P1
• Synonyms gene name
  • mannan-binding lectin serine protease 2
  • mannan-binding lectin serine peptidase 1 pseudogene 1
  • mannan-binding lectin serine protease 1 pseudogene 1
• Synonyms
  • Map19
  • sMAP
  • MAP-2
• Synonyms name
  • mannose-binding lectin-associated serine protease 2
  • mannose-binding lectin associated protein 19
• GenBank acession
  • X98400
• Locus
  1p36.22
• Discovery year
  1998-12-17
• Entrez gene record
  10747
• Pubmed identfication
  • 9087411
  • 9777418
• RefSeq identity
  • NM_006610
• Classification
  • Sushi domain containing
  • Complement system activation components
• VEGA ID
  OTTHUMG00000002121
• Locus Specific Databases
  • MASP2base: Mutation registry for MASP-2 deficiency
  • LRG_82

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products