Rabbit MAS1 antibody
-
Catalog number70R-7020
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenMAS1 antibody was raised using the middle region of MAS1 corresponding to a region with amino acids VIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIII
-
SpecificityMAS1 antibody was raised against the middle region of MAS1
-
Cross ReactivityHuman, Mouse, Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAS1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolMAS1, PMPCB
-
Short nameRabbit MAS1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal MAS1 antibody raised against the middle region of MAS1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetMAS1 oncogene, MAS and MGRA, MAS1 and IDBG-98585 and ENSG00000130368 and 4142, peptide binding, Cell surfaces, Mas1 and IDBG-137347 and ENSMUSG00000068037 and 17171, MAS1 and IDBG-647063 and ENSBTAG00000031724 and 783010
-
Gene info
-
Identity
-
Gene
-
Long gene nameMAS1 proto-oncogene, G protein-coupled receptor
-
Synonyms gene name
- MAS1 oncogene
-
GenBank acession
-
Locus
-
Discovery year1988-07-04
-
Entrez gene record
-
RefSeq identity
-
Classification
- G protein-coupled receptors, Class A orphans
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namepeptidase, mitochondrial processing subunit beta
-
Synonyms gene name
- peptidase (mitochondrial processing) beta
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1999-07-22
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- M16 metallopeptidases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data