Rabbit MAPK3 antibody

  • Catalog number
    70R-5573
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Signal Transduction
  • Immunogen
    MAPK3 antibody was raised using the middle region of MAPK3 corresponding to a region with amino acids LDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
  • Specificity
    MAPK3 antibody was raised against the middle region of MAPK3
  • Cross Reactivity
    Human,Mouse,Rat
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAPK3 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    MAPK3  
  • Gene symbol
    MAPK3
  • Short name
    Rabbit MAPK3 antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal MAPK3 antibody raised against the middle region of MAPK3
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    mitogen-activated protein kinase 3, ERK-1 and ERK1 and ERT2 and HS44KDAP and HUMKER1A and p44-ERK1 and p44-MAPK and P44ERK1 and P44MAPK and PRKM3, MAPK3 and IDBG-25745 and ENSG00000102882 and 5595, transferase activity, nuclei, Mapk3 and IDBG-209781 and ENSMUSG00000063065 and 26417, MAPK3 and IDBG-639178 and ENSBTAG00000016156 and 531391
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee