Rabbit MAPK13 antibody
-
Catalog number70R-5668
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenMAPK13 antibody was raised using the middle region of MAPK13 corresponding to a region with amino acids KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD
-
SpecificityMAPK13 antibody was raised against the middle region of MAPK13
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAPK13 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolMAPK13
-
Short nameRabbit MAPK13 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal MAPK13 antibody raised against the middle region of MAPK13
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetmitogen-activated protein kinase 13, MAPK 13 and MAPK-13 and p38delta and PRKM13 and SAPK4, MAPK13 and IDBG-84731 and ENSG00000156711 and 5603, transferase activity, Cytoplasm, Mapk13 and IDBG-159128 and ENSMUSG00000004864 and 26415, MAPK13 and IDBG-630078 and ENSBTAG00000010007 and 535327
-
Gene info
-
Identity
-
Gene
-
Long gene namemitogen-activated protein kinase 13
-
Synonyms gene
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-04-28
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Mitogen-activated protein kinases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data