Rabbit MAP4K5 antibody
-
Catalog number70R-5780
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenMAP4K5 antibody was raised using the middle region of MAP4K5 corresponding to a region with amino acids QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA
-
SpecificityMAP4K5 antibody was raised against the middle region of MAP4K5
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAP4K5 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolMAP4K5
-
Short nameRabbit MAP4K5 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal MAP4K5 antibody raised against the middle region of MAP4K5
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetmitogen-activated protein kinase kinase kinase kinase 5, GCKR and KHS and KHS1 and MAPKKKK5, MAP4K5 and IDBG-6029 and ENSG00000012983 and 11183, transferase activity, Plasma membranes, Map4k5 and IDBG-144865 and ENSMUSG00000034761 and 399510, MAP4K5 and IDBG-646448 and ENSBTAG00000014792 and 781335
-
Gene info
-
Identity
-
Gene
-
Long gene namemitogen-activated protein kinase kinase kinase kinase 5
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1999-09-07
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Mitogen-activated protein kinase kinase kinase kinases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data