Rabbit MAP4K2 antibody
-
Catalog number70R-5784
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenMAP4K2 antibody was raised using the N terminal of MAP4K2 corresponding to a region with amino acids HLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAE
-
SpecificityMAP4K2 antibody was raised against the N terminal of MAP4K2
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAP4K2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolMAP4K2
-
Short nameRabbit MAP4K2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal MAP4K2 antibody raised against the N terminal of MAP4K2
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetmitogen-activated protein kinase kinase kinase kinase 2, BL44 and GCK and RAB8IP, MAP4K2 and IDBG-55181 and ENSG00000168067 and 5871, transferase activity, Plasma membranes, Map4k2 and IDBG-135906 and ENSMUSG00000024948 and 26412, MAP4K2 and IDBG-643979 and ENSBTAG00000001037 and 520058
-
Gene info
-
Identity
-
Gene
-
Long gene namemitogen-activated protein kinase kinase kinase kinase 2
-
Synonyms gene
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1997-08-18
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Mitogen-activated protein kinase kinase kinase kinases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data