Rabbit MAOB antibody
#
-
Catalog number70R-6478
-
Price:
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaHormones & Steroids
-
ImmunogenMAOB antibody was raised using the C terminal of MAOB corresponding to a region with amino acids GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA
-
SpecificityMAOB antibody was raised against the C terminal of MAOB
-
Cross ReactivityHuman,Dog
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAOB antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolMAOB
-
Short nameRabbit MAOB antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal MAOB antibody raised against the C terminal of MAOB
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetmonoamine oxidase B, MAOB and IDBG-58401 and ENSG00000069535 and 4129, flavin adenine dinucleotide binding, Plasma membranes, Maob and IDBG-133631 and ENSMUSG00000040147 and 109731, MAOB and IDBG-637878 and ENSBTAG00000001288 and 338445
-
Gene info
-
Identity
-
Gene
-
Long gene namemonoamine oxidase B
-
Locus
-
Discovery year1986-01-01
-
Entrez gene record
-
RefSeq identity
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data