Rabbit MAOB antibody

#
  • Catalog number
    70R-6478
  • Price:

    Please ask

    Ask for price
  • Size
    50 ug
# #
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Hormones & Steroids
  • Immunogen
    MAOB antibody was raised using the C terminal of MAOB corresponding to a region with amino acids GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA
  • Specificity
    MAOB antibody was raised against the C terminal of MAOB
  • Cross Reactivity
    Human,Dog
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MAOB antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
#
  • Gene target
    MAOB  
  • Gene symbol
    MAOB
  • Short name
    Rabbit MAOB antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal MAOB antibody raised against the C terminal of MAOB
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    monoamine oxidase B, MAOB and IDBG-58401 and ENSG00000069535 and 4129, flavin adenine dinucleotide binding, Plasma membranes, Maob and IDBG-133631 and ENSMUSG00000040147 and 109731, MAOB and IDBG-637878 and ENSBTAG00000001288 and 338445
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee