Rabbit M6PR antibody

  • Catalog number
    70R-1887
  • Price
    Please ask
  • Size
    100 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Signal Transduction
  • Immunogen
    M6PR antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE
  • Specificity
    NA
  • Cross Reactivity
    Human, Mouse, Rat
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of M6PR antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    M6PR  
  • Gene symbol
    M6PR, IGF2R
  • Short name
    Rabbit M6PR antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal M6PR antibody
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    mannose-6-phosphate receptor (cation dependent), CD-MPR and MPR 46 and MPR-46 and MPR46 and SMPR, M6PR and IDBG-17511 and ENSG00000003056 and 4074, mannose transmembrane transporter activity, Plasma membranes, M6pr and IDBG-185276 and ENSMUSG00000007458 and 17113, M6PR and IDBG-639695 and ENSBTAG00000018207 and 281291
Gene info
  • Identity
  • Gene
  • Long gene name
    mannose-6-phosphate receptor, cation dependent
  • Synonyms gene name
    • mannose-6-phosphate receptor (cation dependent)
  • Synonyms
  • Locus
  • Discovery year
    1989-06-30
  • Entrez gene record
  • Classification
    • MRH domain containing
  • VEGA ID
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee