Rabbit LYVE1 antibody
-
Catalog number70R-6181
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenLYVE1 antibody was raised using the N terminal of LYVE1 corresponding to a region with amino acids ARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQ
-
SpecificityLYVE1 antibody was raised against the N terminal of LYVE1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LYVE1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolLYVE1
-
Short nameRabbit LYVE1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal LYVE1 antibody raised against the N terminal of LYVE1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetlymphatic vessel endothelial hyaluronan receptor 1, CRSBP-1 and HAR and LYVE-1 and XLKD1, LYVE1 and IDBG-31795 and ENSG00000133800 and 10894, hyaluronic acid binding, Plasma membranes, Lyve1 and IDBG-206692 and ENSMUSG00000030787 and 114332, LYVE1 and IDBG-633316 and ENSBTAG00000000802 and 404179
-
Gene info
-
Identity
-
Gene
-
Long gene namelymphatic vessel endothelial hyaluronan receptor 1
-
Synonyms gene
-
Synonyms gene name
- extracellular link domain containing 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2001-03-21
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data