Rabbit LTC4S antibody
-
Catalog number70R-1852
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenLTC4S antibody was raised using the N terminal of LTC4S corresponding to a region with amino acids MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY
-
SpecificityLTC4S antibody was raised against the N terminal of LTC4S
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50 ul distilled water for a 1mg/ml concentration of LTC4S antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolLTC4S
-
Short nameRabbit LTC4S antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameAffinity purified rabbit polyclonal LTC4S antibody raised against the N terminal of LTC4S
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetleukotriene C4 synthase, LTC4S and IDBG-243666 and ENSG00000213316 and 4056, lipid binding, nuclei, Ltc4s and IDBG-168449 and ENSMUSG00000020377 and 17001, LTC4S and IDBG-640977 and ENSBTAG00000009737 and 511749
-
Gene info
-
Identity
-
Gene
-
Long gene nameleukotriene C4 synthase
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1994-11-24
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data