Rabbit LSM14A antibody

• Catalog number
  70R-4243
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  DNA & RNA
• Immunogen
  LSM14A antibody was raised using a synthetic peptide corresponding to a region with amino acids KLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNI
• Specificity
  NA
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LSM14A antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  LSM14A  
• Gene symbol
  LSM14A
• Short name
  Rabbit LSM14A antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal LSM14A antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  LSM14A, SCD6 homolog A (S. cerevisiae), C19orf13 and FAM61A and RAP55 and RAP55A, LSM14A and IDBG-547325 and ENSG00000257103 and 26065, poly(A) RNA binding, Cytoplasm, Lsm14a and IDBG-173430 and ENSMUSG00000066568 and 67070, BT.40231 and IDBG-635346 and ENSBTAG00000000630 and 538838

Gene info

• Identity
  HGNC:24489
• Gene
  LSM14A
• Long gene name
  LSM14A mRNA processing body assembly factor
• Synonyms gene
  • C19orf13
  • FAM61A
• Synonyms gene name
  • chromosome 19 open reading frame 13
  • family with sequence similarity 61, member A
  • LSM14 homolog A (SCD6, S. cerevisiae)
  • LSM14A, mRNA processing body assembly factor
• Synonyms
  • DKFZP434D1335
  • RAP55A
  • RAP55
• Synonyms name
  • RNA-associated protein 55
• GenBank acession
  • AL834398
• Locus
  19q13.11
• Discovery year
  2004-02-11
• Entrez gene record
  26065
• Pubmed identfication
  • 15225602
  • 22745163
• RefSeq identity
  • NM_015578
• Classification
  • LSm proteins
• VEGA ID
  OTTHUMG00000180491

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products