Rabbit LRRC8A antibody
-
Catalog number70R-6392
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenLRRC8A antibody was raised using the N terminal of LRRC8A corresponding to a region with amino acids IPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDK
-
SpecificityLRRC8A antibody was raised against the N terminal of LRRC8A
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC8A antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolLRRC8A
-
Short nameRabbit LRRC8A antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal LRRC8A antibody raised against the N terminal of LRRC8A
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetleucine rich repeat containing 8 family, member A, LRRC8A and IDBG-88771 and ENSG00000136802 and 56262, protein binding, Cell surfaces, LLRC8A and IDBG-639650 and ENSBTAG00000013030 and 505605
-
Gene info
-
Identity
-
Gene
-
Long gene nameleucine rich repeat containing 8 VRAC subunit A
-
Synonyms gene
-
Synonyms gene name
- leucine rich repeat containing 8
- leucine rich repeat containing 8 family member A
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2003-09-26
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Volume regulated anion channel subunits
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data