Rabbit LRG1 antibody

• Catalog number
  70R-4512
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cell Biology
• Immunogen
  LRG1 antibody was raised using the N terminal of LRG1 corresponding to a region with amino acids GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP
• Specificity
  LRG1 antibody was raised against the N terminal of LRG1
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRG1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  LRG1  
• Gene symbol
  LRG1
• Short name
  Rabbit LRG1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal LRG1 antibody raised against the N terminal of LRG1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  leucine-rich alpha-2-glycoprotein 1, LRG1 and IDBG-19050 and ENSG00000171236 and 116844, protein binding, Extracellular, Lrg1 and IDBG-191684 and ENSMUSG00000037095 and 76905, LRG1 and IDBG-644250 and ENSBTAG00000031647 and 514663

Gene info

• Identity
  HGNC:29480
• Gene
  LRG1
• Long gene name
  leucine rich alpha-2-glycoprotein 1
• Synonyms
  • LRG
• Synonyms name
  • leucine rich alpha 2 glycoprotein
• Locus
  19p13.3
• Discovery year
  2004-02-12
• Entrez gene record
  116844
• Pubmed identfication
  • 3856868
  • 12223515
• RefSeq identity
  • NM_052972
• VEGA ID
  OTTHUMG00000182010

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products