Rabbit LIN7C antibody

• Catalog number
  70R-2196
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Neuroscience
• Immunogen
  LIN7C antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV
• Specificity
  NA
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LIN7C antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  LIN7C  
• Gene symbol
  LIN7C
• Short name
  Rabbit LIN7C antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal LIN7C antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  lin-7 homolog C (C. elegans), LIN7C and IDBG-36749 and ENSG00000148943 and 55327, L27 domain binding, Cell surfaces, Lin7c and IDBG-195526 and ENSMUSG00000027162 and 22343, LIN7C and IDBG-636096 and ENSBTAG00000001460 and 510125

Gene info

• Identity
  HGNC:17789
• Gene
  LIN7C
• Long gene name
  lin-7 homolog C, crumbs cell polarity complex component
• Synonyms gene name
  • lin-7 homolog C (C. elegans)
• Synonyms
  • MALS-3
  • LIN-7C
  • LIN-7-C
  • VELI3
  • FLJ11215
• Synonyms name
  • LIN-7 protein 3
• GenBank acession
  • AK002077
• Locus
  11p14.1
• Discovery year
  2002-09-19
• Entrez gene record
  55327
• Pubmed identfication
  • 10341223
• RefSeq identity
  • NM_018362
• Classification
  • PDZ domain containing
  • Crumbs complex
• VEGA ID
  OTTHUMG00000166193

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products