Rabbit LIG4 antibody
-
Catalog number70R-1623
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB, IHC
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenLIG4 antibody was raised using the N terminal of LIG4 corresponding to a region with amino acids DGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQ
-
SpecificityLIG4 antibody was raised against the N terminal of LIG4
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of LIG4 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolLIG4
-
Short nameRabbit LIG4 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal LIG4 antibody raised against the N terminal of LIG4
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetligase IV, DNA, ATP-dependent, LIG4S, LIG4 and IDBG-49744 and ENSG00000174405 and 3981, metal ion binding, nuclei, Lig4 and IDBG-131943 and ENSMUSG00000049717 and 319583, LIG4 and IDBG-633610 and ENSBTAG00000015868 and 781252
-
Gene info
-
Identity
-
Gene
-
Long gene nameDNA ligase 4
-
Synonyms gene name
- ligase IV, DNA, ATP-dependent
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1995-08-10
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- DNA ligases
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data