Rabbit LIAS antibody
-
Catalog number70R-2254
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProtein Modification & Stress Response
-
ImmunogenLIAS antibody was raised using the N terminal of LIAS corresponding to a region with amino acids LLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQKGERLRLPPWLKTEIPMG
-
SpecificityLIAS antibody was raised against the N terminal of LIAS
-
Cross ReactivityHuman,Mouse
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LIAS antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolLIAS
-
Short nameRabbit LIAS antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal LIAS antibody raised against the N terminal of LIAS
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetlipoic acid synthetase, LAS and LIP1 and LS and PDHLD, LIAS and IDBG-14368 and ENSG00000121897 and 11019, 4 iron, multiple, Lias and IDBG-166563 and ENSMUSG00000029199 and 79464, LIAS and IDBG-641738 and ENSBTAG00000014520 and 530865
-
Gene info
-
Identity
-
Gene
-
Long gene namelipoic acid synthetase
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2001-11-30
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Radical S-adenosylmethionine domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data