Rabbit LGALS3BP antibody

• Catalog number
  70R-6085
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cell Biology
• Immunogen
  LGALS3BP antibody was raised using the middle region of LGALS3BP corresponding to a region with amino acids NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS
• Specificity
  LGALS3BP antibody was raised against the middle region of LGALS3BP
• Cross Reactivity
  Human,Mouse
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LGALS3BP antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  LGALS3BP  
• Gene symbol
  LGALS3BP
• Short name
  Rabbit LGALS3BP antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal LGALS3BP antibody raised against the middle region of LGALS3BP
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  lectin, galactoside-binding, soluble, 3 binding protein, 90K and BTBD17B and CyCAP and gp90 and M2BP and MAC-2-BP and TAN this GO 10B, LGALS3BP and IDBG-71005 and ENSG00000108679 and 3959, protein binding, Extracellular, Lgals3bp and IDBG-214638 and ENSMUSG00000033880 and 19039, LGALS3BP and IDBG-642788 and ENSBTAG00000001368 and 531137

Gene info

• Identity
  HGNC:6564
• Gene
  LGALS3BP
• Long gene name
  galectin 3 binding protein
• Synonyms gene name
  • lectin, galactoside-binding, soluble, 3 binding protein
• Synonyms
  • MAC-2-BP
  • 90K
  • BTBD17B
  • TANGO10B
  • M2BP
  • gp90
  • CyCAP
• Synonyms name
  • L3 antigen
  • Mac-2-binding protein
  • serum protein 90K
  • transport and golgi organization 10 homolog B (Drosophila)
• GenBank acession
  • L13210
• Locus
  17q25
• Discovery year
  1994-09-30
• Entrez gene record
  3959
• Pubmed identfication
  • 7698018
  • 8034587
  • 8390986
• RefSeq identity
  • NM_005567
• Classification
  • BTB domain containing
  • Scavenger receptor cysteine rich domain containing
  • Receptor ligands
• VEGA ID
  OTTHUMG00000177572

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products