Rabbit LECT1 antibody

• Catalog number
  70R-6248
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  LECT1 antibody was raised using the N terminal of LECT1 corresponding to a region with amino acids AIAVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGK
• Specificity
  LECT1 antibody was raised against the N terminal of LECT1
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LECT1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  LECT1  
• Gene symbol
  CNMD
• Short name
  Rabbit LECT1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal LECT1 antibody raised against the N terminal of LECT1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  leukocyte cell derived chemotaxin 1, BRICD3 and CHM-I and CHM1 and MYETS1, LECT1 and IDBG-35924 and ENSG00000136110 and 11061, Extracellular, Lect1 and IDBG-183045 and ENSMUSG00000022025 and 16840, LECT1 and IDBG-628626 and ENSBTAG00000025502 and 281683

Gene info

• Identity
  HGNC:17005
• Gene
  CNMD
• Long gene name
  chondromodulin
• Synonyms gene
  • MYETS1
  • LECT1
• Synonyms gene name
  • multiple myeloma tumor suppressor 1
  • leukocyte cell derived chemotaxin 1
• Synonyms
  • CHM-I
  • CHM1
  • BRICD3
• Synonyms name
  • BRICHOS domain containing 3
• GenBank acession
  • AB006000
• Locus
  13q14.3
• Discovery year
  2003-02-18
• Entrez gene record
  11061
• Pubmed identfication
  • 9731231
  • 10103018
• Classification
  • BRICHOS domain containing
• VEGA ID
  OTTHUMG00000016980

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products