Rabbit LDLRAP1 antibody
-
Catalog number70R-2837
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenLDLRAP1 antibody was raised using the N terminal of LDLRAP1 corresponding to a region with amino acids WTDTRETLLEGMLFSLKYLGMTLVEQPKGEELSAAAIKRIVATAKASGKK
-
SpecificityLDLRAP1 antibody was raised against the N terminal of LDLRAP1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LDLRAP1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolLDLRAP1
-
Short nameRabbit LDLRAP1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal LDLRAP1 antibody raised against the N terminal of LDLRAP1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetlow density lipoprotein receptor adaptor protein 1, LDLRAP1 and IDBG-94355 and ENSG00000157978 and 26119, phosphatidylinositol-4, Plasma membranes, Ldlrap1 and IDBG-196506 and ENSMUSG00000037295 and 100017, LDLRAP1 and IDBG-645279 and ENSBTAG00000001050 and 511199
-
Gene info
-
Identity
-
Gene
-
Long gene namelow density lipoprotein receptor adaptor protein 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2005-02-24
-
Entrez gene record
-
RefSeq identity
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data