Rabbit LCP1 antibody
-
Catalog number70R-2221
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenLCP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FIKIFHGLKSTDVAKTFRKAINKKEGICAIGGTSEQSSVGTQHSYSEEEK
-
SpecificityNA
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LCP1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolTOX4, LCP1
-
Short nameRabbit LCP1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal LCP1 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetlymphocyte cytosolic protein 1 (L-plastin), CP64 and HEL-S-37 and L-PLASTIN and LC64P and LPL and PLS2, LCP1 and IDBG-30382 and ENSG00000136167 and 3936, actin filament binding, Extracellular, Lcp1 and IDBG-180662 and ENSMUSG00000021998 and 18826, BT.49547 and IDBG-628934 and ENSBTAG00000007079 and 540990
-
Gene info
-
Identity
-
Gene
-
Long gene nameTOX high mobility group box family member 4
-
Synonyms gene
-
Synonyms gene name
- chromosome 14 open reading frame 92
- KIAA0737
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2002-12-19
-
Entrez gene record
-
RefSeq identity
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namelymphocyte cytosolic protein 1
-
Synonyms gene name
- lymphocyte cytosolic protein 1 (L-plastin)
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1986-01-01
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- EF-hand domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data