Rabbit LCK antibody
-
Catalog number70R-2658
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenLCK antibody was raised using the N terminal of LCK corresponding to a region with amino acids PSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLE
-
SpecificityLCK antibody was raised against the N terminal of LCK
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LCK antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolLCK
-
Short nameRabbit LCK antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal LCK antibody raised against the N terminal of LCK
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetlymphocyte-specific protein tyrosine kinase, IMD22 and LSK and p56lck and pp58lck and YT16, LCK and IDBG-95667 and ENSG00000182866 and 3932, transferase activity, Cell surfaces, Lck and IDBG-191117 and ENSMUSG00000000409 and 16818, LCK and IDBG-644592 and ENSBTAG00000012695 and 508890
-
Gene info
-
Identity
-
Gene
-
Long gene nameLCK proto-oncogene, Src family tyrosine kinase
-
Synonyms gene name
- lymphocyte-specific protein tyrosine kinase
-
GenBank acession
-
Locus
-
Discovery year1986-01-01
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Src family tyrosine kinases
- SH2 domain containing
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data