Rabbit LCK antibody

  • Catalog number
    70R-2658
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Immunology
  • Immunogen
    LCK antibody was raised using the N terminal of LCK corresponding to a region with amino acids PSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLE
  • Specificity
    LCK antibody was raised against the N terminal of LCK
  • Cross Reactivity
    Human,Mouse,Rat
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LCK antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    LCK  
  • Gene symbol
    LCK
  • Short name
    Rabbit LCK antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal LCK antibody raised against the N terminal of LCK
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    lymphocyte-specific protein tyrosine kinase, IMD22 and LSK and p56lck and pp58lck and YT16, LCK and IDBG-95667 and ENSG00000182866 and 3932, transferase activity, Cell surfaces, Lck and IDBG-191117 and ENSMUSG00000000409 and 16818, LCK and IDBG-644592 and ENSBTAG00000012695 and 508890
Gene info
  • Identity
  • Gene
    LCK
  • Long gene name
    LCK proto-oncogene, Src family tyrosine kinase
  • Synonyms gene name
    • lymphocyte-specific protein tyrosine kinase
  • GenBank acession
  • Locus
  • Discovery year
    1986-01-01
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Src family tyrosine kinases
    • SH2 domain containing
  • VEGA ID
  • Locus Specific Databases
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee