Rabbit LAIR2 antibody

• Catalog number
  70R-5297
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Immunology
• Immunogen
  LAIR2 antibody was raised using the N terminal of LAIR2 corresponding to a region with amino acids SPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVISPGSHVTFMCRG
• Specificity
  LAIR2 antibody was raised against the N terminal of LAIR2
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LAIR2 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  LAIR2  
• Gene symbol
  LAIR2
• Short name
  Rabbit LAIR2 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal LAIR2 antibody raised against the N terminal of LAIR2
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  leukocyte-associated immunoglobulin-like receptor 2, CD306, LAIR2 and IDBG-68779 and ENSG00000167618 and 3904, Extracellular

Gene info

• Identity
  HGNC:6478
• Gene
  LAIR2
• Long gene name
  leukocyte associated immunoglobulin like receptor 2
• Synonyms gene name
  • leukocyte-associated Ig-like receptor 2
  • leukocyte-associated immunoglobulin-like receptor 2
• Synonyms
  • CD306
  • LAIR-2
• GenBank acession
  • AF013250
• Locus
  19q13.42
• Discovery year
  1997-07-25
• Entrez gene record
  3904
• Pubmed identfication
  • 9285412
• Classification
  • Immunoglobulin like domain containing
  • CD molecules
• VEGA ID
  OTTHUMG00000065697

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products