Rabbit KNG1 antibody
-
Catalog number70R-2920
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenKNG1 antibody was raised using the middle region of KNG1 corresponding to a region with amino acids YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK
-
SpecificityKNG1 antibody was raised against the middle region of KNG1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KNG1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolKNG1
-
Short nameRabbit KNG1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal KNG1 antibody raised against the middle region of KNG1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetkininogen 1, BDK and BK and KNG, KNG1 and IDBG-69059 and ENSG00000113889 and 3827, zinc ion binding, Extracellular, KNG1 and IDBG-634652 and ENSBTAG00000005122 and 280833
-
Gene info
-
Identity
-
Gene
-
Long gene namekininogen 1
-
Synonyms gene
-
Synonyms gene name
- kininogen
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year1990-07-26
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Cystatins, type 3
- Neuropeptides
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data