Rabbit KITLG antibody
-
Catalog number70R-6096
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCytokines & Growth Factors
-
ImmunogenKITLG antibody was raised using the middle region of KITLG corresponding to a region with amino acids TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG
-
SpecificityKITLG antibody was raised against the middle region of KITLG
-
Cross ReactivityHuman,Mouse,Rat,Dog
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KITLG antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolKITLG
-
Short nameRabbit KITLG antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal KITLG antibody raised against the middle region of KITLG
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetKIT ligand, FPH2 and Kitl and KL-1 and MGF and SCF and SF and SHEP7, KITLG and IDBG-50398 and ENSG00000049130 and 4254, growth factor activity, Extracellular, Kitl and IDBG-187862 and ENSMUSG00000019966 and 17311, KITLG and IDBG-630711 and ENSBTAG00000017549 and 281885
-
Gene info
-
Identity
-
Gene
-
Long gene nameKIT ligand
-
Synonyms gene
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1991-06-04
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data