Rabbit KIRREL2 antibody

• Catalog number
  70R-6136
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  KIRREL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVLV
• Specificity
  NA
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIRREL2 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  KIRREL2  
• Gene symbol
  KIRREL2
• Short name
  Rabbit KIRREL2 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal KIRREL2 antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  kin of IRRE like 2 (Drosophila), KIRREL2 and IDBG-45718 and ENSG00000126259 and 84063, protein binding, Cell surfaces, Kirrel2 and IDBG-169097 and ENSMUSG00000036915 and 243911, KIRREL2 and IDBG-636011 and ENSBTAG00000007826 and 538843

Gene info

• Identity
  HGNC:18816
• Gene
  KIRREL2
• Long gene name
  kirre like nephrin family adhesion molecule 2
• Synonyms gene name
  • kin of IRRE like 2 (Drosophila)
• Synonyms
  • NLG1
  • NEPH3
  • FILTRIN
  • DKFZp564A1164
  • MGC15718
• GenBank acession
  • AL136654
• Locus
  19q13.12
• Discovery year
  2002-07-01
• Entrez gene record
  84063
• Pubmed identfication
  • 12837264
  • 12504092
• RefSeq identity
  • NM_032123
• Classification
  • C2-set domain containing
  • I-set domain containing
• VEGA ID
  OTTHUMG00000180691

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products