Rabbit KIF13B antibody

• Catalog number
  70R-5670
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  KIF13B antibody was raised using the N terminal of KIF13B corresponding to a region with amino acids SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE
• Specificity
  KIF13B antibody was raised against the N terminal of KIF13B
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIF13B antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  KIF13B  
• Gene symbol
  KIF13B
• Short name
  Rabbit KIF13B antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal KIF13B antibody raised against the N terminal of KIF13B
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  kinesin family member 13B, GAKIN, KIF13B and IDBG-15452 and ENSG00000197892 and 23303, 14-3-3 protein binding, Cytoplasm, Kif13b and IDBG-173359 and ENSMUSG00000060012 and 16554, KIF13B and IDBG-629514 and ENSBTAG00000017232 and 534909

Gene info

• Identity
  HGNC:14405
• Gene
  KIF13B
• Long gene name
  kinesin family member 13B
• Synonyms
  • GAKIN
  • KIAA0639
• Synonyms name
  • guanylate kinase associated kinesin
• GenBank acession
  • AB014539
• Locus
  8p12
• Discovery year
  2001-02-28
• Entrez gene record
  23303
• Pubmed identfication
  • 9734811
  • 10859302
  • 16864656
• Classification
  • Kinesins
• VEGA ID
  OTTHUMG00000164032

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products