Rabbit JAKMIP1 antibody
-
Catalog number70R-4722
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenJAKMIP1 antibody was raised using the middle region of JAKMIP1 corresponding to a region with amino acids FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE
-
SpecificityJAKMIP1 antibody was raised against the middle region of JAKMIP1
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of JAKMIP1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolJAKMIP1-DT, JAKMIP1
-
Short nameRabbit JAKMIP1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal JAKMIP1 antibody raised against the middle region of JAKMIP1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetjanus kinase and microtubule interacting protein 1, JAKMIP1 and IDBG-8838 and ENSG00000152969 and 152789, GABA receptor binding, Plasma membranes, Jakmip1 and IDBG-158685 and ENSMUSG00000063646 and 76071, JAKMIP1 and IDBG-643363 and ENSBTAG00000011170 and 540970
-
Gene info
-
Identity
-
Gene
-
Long gene nameJAKMIP1 divergent transcript
-
Synonyms gene
-
Synonyms gene name
- long intergenic non-protein coding RNA 2495
-
Locus
-
Discovery year2017-05-03
-
Entrez gene record
-
RefSeq identity
-
Classification
- Divergent transcripts
Gene info
-
Identity
-
Gene
-
Long gene namejanus kinase and microtubule interacting protein 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2006-02-23
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data