Rabbit IZUMO1 antibody
-
Catalog number70R-7523
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenIZUMO1 antibody was raised using the C terminal of IZUMO1 corresponding to a region with amino acids SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ
-
SpecificityIZUMO1 antibody was raised against the C terminal of IZUMO1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IZUMO1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolIZUMO1
-
Short nameRabbit IZUMO1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal IZUMO1 antibody raised against the C terminal of IZUMO1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetizumo sperm-egg fusion 1, IZUMO1 and IDBG-61071 and ENSG00000182264 and 284359, protein homodimerization activity, Plasma membranes, Izumo1 and IDBG-183832 and ENSMUSG00000064158 and 73456, IZUMO1 and IDBG-640279 and ENSBTAG00000011621 and 618057
-
Gene info
-
Identity
-
Gene
-
Long gene nameizumo sperm-egg fusion 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2005-06-01
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Ig-like cell adhesion molecule family
- IZUMO family
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data