Rabbit ITGB3BP antibody

• Catalog number
  70R-6093
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Immunology
• Immunogen
  ITGB3BP antibody was raised using a synthetic peptide corresponding to a region with amino acids TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE
• Specificity
  NA
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ITGB3BP antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  ITGB3BP  
• Gene symbol
  ITGB3BP
• Short name
  Rabbit ITGB3BP antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal ITGB3BP antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  integrin beta 3 binding protein (beta3-endonexin), CENP-R and CENPR and HSU37139 and NRIF3 and TAP20, ITGB3BP and IDBG-99389 and ENSG00000142856 and 23421, protein C-terminus binding, nuclei, Itgb3bp and IDBG-166584 and ENSMUSG00000028549 and 67733, ITGB3BP and IDBG-638555 and ENSBTAG00000030710 and 614469

Gene info

• Identity
  HGNC:6157
• Gene
  ITGB3BP
• Long gene name
  integrin subunit beta 3 binding protein
• Synonyms gene name
  • integrin beta 3 binding protein (beta3-endonexin)
• Synonyms
  • NRIF3
  • HSU37139
  • TAP20
  • CENPR
• Synonyms name
  • centromere protein R
  • beta3-endonexin
• GenBank acession
  • U37139
• Locus
  1p31.3
• Discovery year
  2000-05-08
• Entrez gene record
  23421
• Pubmed identfication
  • 7593198
  • 10490654
• RefSeq identity
  • NM_014288
• Classification
  • Constitutive centromere associated network
• VEGA ID
  OTTHUMG00000013364

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products