Rabbit ITGB1BP2 antibody
-
Catalog number70R-1183
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB, IHC
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenITGB1BP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDF
-
SpecificityNA
-
Cross ReactivityHuman, Mouse, Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ITGB1BP2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolITGB1BP2
-
Short nameRabbit ITGB1BP2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ITGB1BP2 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetintegrin beta 1 binding protein (melusin) 2, ITGB1BP2 and IDBG-76020 and ENSG00000147166 and 26548, SH3 domain binding, multiple, Itgb1bp2 and IDBG-164253 and ENSMUSG00000031312 and 26549, ITGB1BP2 and IDBG-635885 and ENSBTAG00000012163 and 539945
-
Gene info
-
Identity
-
Gene
-
Long gene nameintegrin subunit beta 1 binding protein 2
-
Synonyms gene name
- integrin beta 1 binding protein 2
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2000-02-11
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data