Rabbit ISG20 antibody
-
Catalog number70R-4698
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenISG20 antibody was raised using the middle region of ISG20 corresponding to a region with amino acids TSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATM
-
SpecificityISG20 antibody was raised against the middle region of ISG20
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ISG20 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolISG20
-
Short nameRabbit ISG20 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ISG20 antibody raised against the middle region of ISG20
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetinterferon stimulated exonuclease gene 20kDa, CD25 and HEM45, ISG20 and IDBG-28713 and ENSG00000172183 and 3669, metal ion binding, nuclei, Isg20 and IDBG-193515 and ENSMUSG00000039236 and 57444, ISG20 and IDBG-628915 and ENSBTAG00000014762 and 506604
-
Gene info
-
Identity
-
Gene
-
Long gene nameinterferon stimulated exonuclease gene 20
-
Synonyms gene name
- interferon stimulated exonuclease gene 20kDa
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-01-30
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Exonucleases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data