Rabbit IRAK3 antibody
-
Catalog number70R-5023
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCytokines & Growth Factors
-
ImmunogenIRAK3 antibody was raised using the C terminal of IRAK3 corresponding to a region with amino acids NTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL
-
SpecificityIRAK3 antibody was raised against the C terminal of IRAK3
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IRAK3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolIRAK3
-
Short nameRabbit IRAK3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal IRAK3 antibody raised against the C terminal of IRAK3
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetinterleukin-1 receptor-associated kinase 3, ASRT5 and IRAKM, IRAK3 and IDBG-45584 and ENSG00000090376 and 11213, transferase activity, nuclei, Irak3 and IDBG-192499 and ENSMUSG00000020227 and 73914, IRAKM and IDBG-634310 and ENSBTAG00000007636 and 510342
-
Gene info
-
Identity
-
Gene
-
Long gene nameinterleukin 1 receptor associated kinase 3
-
Synonyms gene name
- interleukin-1 receptor-associated kinase 3
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2002-07-17
-
Entrez gene record
-
Pubmed identfication
-
Classification
- MicroRNA protein coding host genes
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data