Rabbit ING3 antibody
-
Catalog number70R-3052
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenING3 antibody was raised using the middle region of ING3 corresponding to a region with amino acids LSSGTGAGAITMAAAQAVQATAQMKEGRRTSSLKASYEAFKNNDFQLGKE
-
SpecificityING3 antibody was raised against the middle region of ING3
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ING3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolING3
-
Short nameRabbit ING3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ING3 antibody raised against the middle region of ING3
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetinhibitor of growth family, member 3, ING3 and IDBG-38115 and ENSG00000071243 and 54556, methylated histone binding, nuclei, Ing3 and IDBG-129480 and ENSMUSG00000029670 and 71777, ING3 and IDBG-634682 and ENSBTAG00000016332 and 513000
-
Gene info
-
Identity
-
Gene
-
Long gene nameinhibitor of growth family member 3
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2001-02-09
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- PHD finger proteins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data