Rabbit ILDR1 antibody
-
Catalog number70R-7528
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenILDR1 antibody was raised using the middle region of ILDR1 corresponding to a region with amino acids RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV
-
SpecificityILDR1 antibody was raised against the middle region of ILDR1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ILDR1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolILDR1
-
Short nameRabbit ILDR1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ILDR1 antibody raised against the middle region of ILDR1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetimmunoglobulin-like domain containing receptor 1, ILDR1 and IDBG-52283 and ENSG00000145103 and 286676, high-density lipoprotein particle receptor activity, Plasma membranes, Ildr1 and IDBG-158192 and ENSMUSG00000022900 and 106347, ILDR1 and IDBG-633257 and ENSBTAG00000004705 and 538495
-
Gene info
-
Identity
-
Gene
-
Long gene nameimmunoglobulin like domain containing receptor 1
-
Synonyms gene
-
Synonyms gene name
- deafness, autosomal recessive 42
- immunoglobulin-like domain containing receptor 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2004-07-27
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data