Rabbit IL33 antibody
-
Catalog number70R-3671
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCytokines & Growth Factors
-
ImmunogenIL33 antibody was raised using the N terminal of IL33 corresponding to a region with amino acids AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC
-
SpecificityIL33 antibody was raised against the N terminal of IL33
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL33 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolIL33
-
Short nameRabbit IL33 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal IL33 antibody raised against the N terminal of IL33
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetinterleukin 33, IL33 and IDBG-48350 and ENSG00000137033 and 90865, protein binding, nuclei, Il33 and IDBG-157638 and ENSMUSG00000024810 and 77125, IL33 and IDBG-631251 and ENSBTAG00000018347 and 507054
-
Gene info
-
Identity
-
Gene
-
Long gene nameinterleukin 33
-
Synonyms gene
-
Synonyms gene name
- chromosome 9 open reading frame 26 (NF-HEV)
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2003-12-18
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Interleukins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data