Rabbit IL18R1 antibody
-
Catalog number70R-6627
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCytokines & Growth Factors
-
ImmunogenIL18R1 antibody was raised using the N terminal of IL18R1 corresponding to a region with amino acids PFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLE
-
SpecificityIL18R1 antibody was raised against the N terminal of IL18R1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL18R1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolIL18R1
-
Short nameRabbit IL18R1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal IL18R1 antibody raised against the N terminal of IL18R1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetinterleukin 18 receptor 1, CD218a and CDw218a and IL-1Rrp and IL18RA and IL1RRP, IL18R1 and IDBG-64199 and ENSG00000115604 and 8809, interleukin-18 receptor activity, Plasma membranes, Il18r1 and IDBG-148535 and ENSMUSG00000026070 and 16182, IL18R1 and IDBG-630853 and ENSBTAG00000001034 and 407221
-
Gene info
-
Identity
-
Gene
-
Long gene nameinterleukin 18 receptor 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-12-17
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Immunoglobulin like domain containing
- TIR domain containing
- CD molecules
- Interleukin receptors
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data