Rabbit IL15 antibody

• Catalog number
  70R-5910
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cytokines & Growth Factors
• Immunogen
  IL15 antibody was raised using the N terminal of IL15 corresponding to a region with amino acids RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV
• Specificity
  IL15 antibody was raised against the N terminal of IL15
• Cross Reactivity
  Human,Mouse,Rat
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IL15 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  IL15  
• Gene symbol
  IL15
• Short name
  Rabbit IL15 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal IL15 antibody raised against the N terminal of IL15
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  interleukin 15, IL-15, IL15 and IDBG-39028 and ENSG00000164136 and 3600, protein binding, nuclei, Il15 and IDBG-171492 and ENSMUSG00000031712 and 16168, IL15 and IDBG-629577 and ENSBTAG00000018200 and 281248

Gene info

• Identity
  HGNC:5977
• Gene
  IL15
• Long gene name
  interleukin 15
• Synonyms
  • IL-15
  • MGC9721
• GenBank acession
  • U14407
• Locus
  4q31.21
• Discovery year
  1994-07-11
• Entrez gene record
  3600
• Pubmed identfication
  • 8178155
• RefSeq identity
  • NM_172175
• Classification
  • Interleukins
• VEGA ID
  OTTHUMG00000133418

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products