Rabbit IGSF9 antibody
-
Catalog number70R-7213
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenIGSF9 antibody was raised using the N terminal of IGSF9 corresponding to a region with amino acids SPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFA
-
SpecificityIGSF9 antibody was raised against the N terminal of IGSF9
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IGSF9 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolIGSF9
-
Short nameRabbit IGSF9 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal IGSF9 antibody raised against the N terminal of IGSF9
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetimmunoglobulin superfamily, member 9, IGSF9 and IDBG-103959 and ENSG00000085552 and 57549, protein binding, Cell surfaces, Igsf9 and IDBG-205479 and ENSMUSG00000037995 and 93842, IGSF9 and IDBG-630662 and ENSBTAG00000001481 and 504209
-
Gene info
-
Identity
-
Gene
-
Long gene nameimmunoglobulin superfamily member 9
-
Synonyms gene name
- immunoglobulin superfamily, member 9
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2002-05-29
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Fibronectin type III domain containing
- I-set domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data