Rabbit IGSF11 antibody
-
Catalog number70R-6403
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenIGSF11 antibody was raised using the middle region of IGSF11 corresponding to a region with amino acids EKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLL
-
SpecificityIGSF11 antibody was raised against the middle region of IGSF11
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IGSF11 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolIGSF11-AS1, IGSF11
-
Short nameRabbit IGSF11 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal IGSF11 antibody raised against the middle region of IGSF11
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetimmunoglobulin superfamily, member 11, IGSF11 and IDBG-51041 and ENSG00000144847 and 152404, protein binding, Plasma membranes, Igsf11 and IDBG-160812 and ENSMUSG00000022790 and 207683, BT.90639 and IDBG-632707 and ENSBTAG00000045704 and 540003
-
Gene info
-
Identity
-
Gene
-
Long gene nameIGSF11 antisense RNA 1
-
Synonyms gene name
- IGSF11 antisense RNA 1 (non-protein coding)
-
Locus
-
Discovery year2011-07-28
-
Entrez gene record
-
Classification
- Antisense RNAs
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameimmunoglobulin superfamily member 11
-
Synonyms gene name
- immunoglobulin superfamily, member 11
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2002-12-04
-
Entrez gene record
-
Pubmed identfication
-
Classification
- IgCAM CXADR-related subfamily
- I-set domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data