Rabbit IGLL1 antibody

• Catalog number
  70R-1641
• Price
  Please ask
• Size
  100 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Immunology
• Immunogen
  IGLL1 antibody was raised using the N terminal of IGLL1 corresponding to a region with amino acids RSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKAT
• Specificity
  IGLL1 antibody was raised against the N terminal of IGLL1
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of IGLL1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  IGLL1  
• Gene symbol
  IGLL1
• Short name
  Rabbit IGLL1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal IGLL1 antibody raised against the N terminal of IGLL1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  immunoglobulin lambda-like polypeptide 1, 14.1 and AGM2 and CD179b and IGL1 and IGL5 and IGLJ14.1 and IGLL and I this GO and IGVPB and VPREB2, IGLL1 and IDBG-2433 and ENSG00000128322 and 3543, protein binding, Plasma membranes

Gene info

• Identity
  HGNC:5870
• Gene
  IGLL1
• Long gene name
  immunoglobulin lambda like polypeptide 1
• Synonyms gene
  • IGLL
• Synonyms gene name
  • immunoglobulin lambda-like polypeptide 1
• Synonyms
  • IGVPB
  • IGL5
  • 14.1
  • CD179B
• Synonyms name
  • lambda 5
• GenBank acession
  • X52204
• Locus
  22q11.23
• Discovery year
  1991-09-12
• Entrez gene record
  3543
• Pubmed identfication
  • 3139558
  • 2511029
• RefSeq identity
  • NM_020070
• Classification
  • C1-set domain containing
  • CD molecules
• VEGA ID
  OTTHUMG00000150673
• Locus Specific Databases
  • IGLL1base: Mutation registry for λ 5 surrogate light-chain deficiency
  • LRG_69

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products