Rabbit IGFBP7 antibody
-
Catalog number70R-5313
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCytokines & Growth Factors
-
ImmunogenIGFBP7 antibody was raised using the C terminal of IGFBP7 corresponding to a region with amino acids RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH
-
SpecificityIGFBP7 antibody was raised against the C terminal of IGFBP7
-
Cross ReactivityHuman,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IGFBP7 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolIGFBP7-AS1, IGFBP7
-
Short nameRabbit IGFBP7 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal IGFBP7 antibody raised against the C terminal of IGFBP7
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetinsulin-like growth factor binding protein 7, AGM and FSTL2 and IBP-7 and IGFBP-7 and IGFBP-7v and IGFBPRP1 and MAC25 and PSF and RAMSVPS and TAF, IGFBP7 and IDBG-20639 and ENSG00000163453 and 3490, insulin-like growth factor binding, Extracellular, Igfbp7 and IDBG-174285 and ENSMUSG00000036256 and 29817, IGFBP7 and IDBG-642609 and ENSBTAG00000019368 and 616368
-
Gene info
-
Identity
-
Gene
-
Long gene nameIGFBP7 antisense RNA 1
-
Locus
-
Discovery year2013-09-17
-
Entrez gene record
-
Classification
- Antisense RNAs
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameinsulin like growth factor binding protein 7
-
Synonyms gene name
- insulin-like growth factor binding protein 7
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-03-02
-
Entrez gene record
-
Pubmed identfication
-
Classification
- I-set domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data