Rabbit IGFALS antibody
-
Catalog number70R-6072
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCytokines & Growth Factors
-
ImmunogenIGFALS antibody was raised using the middle region of IGFALS corresponding to a region with amino acids DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPE
-
SpecificityIGFALS antibody was raised against the middle region of IGFALS
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IGFALS antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolIGFALS
-
Short nameRabbit IGFALS antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal IGFALS antibody raised against the middle region of IGFALS
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetinsulin-like growth factor binding protein, acid labile subunit, ACLSD and ALS, IGFALS and IDBG-9328 and ENSG00000099769 and 3483, insulin-like growth factor binding, nuclei, Igfals and IDBG-149536 and ENSMUSG00000046070 and 16005, BT.24635 and IDBG-648693 and ENSBTAG00000033299 and 532494
-
Gene info
-
Identity
-
Gene
-
Long gene nameinsulin like growth factor binding protein acid labile subunit
-
Synonyms gene name
- insulin-like growth factor binding protein, acid labile subunit
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1997-11-28
-
Entrez gene record
-
Pubmed identfication
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data