Rabbit IFRD1 antibody
-
Catalog number70R-3682
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenIFRD1 antibody was raised using the middle region of IFRD1 corresponding to a region with amino acids LALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVF
-
SpecificityIFRD1 antibody was raised against the middle region of IFRD1
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IFRD1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolIFRD1
-
Short nameRabbit IFRD1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal IFRD1 antibody raised against the middle region of IFRD1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetinterferon-related developmental regulator 1, PC4 and TIS7, IFRD1 and IDBG-36786 and ENSG00000006652 and 3475, binding, nuclei, Ifrd1 and IDBG-136330 and ENSMUSG00000001627 and 15982, IFRD1 and IDBG-632907 and ENSBTAG00000010549 and 541283
-
Gene info
-
Identity
-
Gene
-
Long gene nameinterferon related developmental regulator 1
-
Synonyms gene name
- interferon-related developmental regulator 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-01-21
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Armadillo like helical domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data