Rabbit IFIH1 antibody
-
Catalog number70R-4787
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsIHC, WB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenIFIH1 antibody was raised using the middle region of IFIH1 corresponding to a region with amino acids QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDED
-
SpecificityIFIH1 antibody was raised against the middle region of IFIH1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IFIH1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolIFIH1
-
Short nameRabbit IFIH1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal IFIH1 antibody raised against the middle region of IFIH1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetinterferon induced with helicase C domain 1, IFIH1 and IDBG-73750 and ENSG00000115267 and 64135, hydrolase activity, nuclei, Ifih1 and IDBG-174129 and ENSMUSG00000026896 and 71586, IFIH1 and IDBG-641195 and ENSBTAG00000008142 and 535490
-
Gene info
-
Identity
-
Gene
-
Long gene nameinterferon induced with helicase C domain 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2004-06-25
-
Entrez gene record
-
RefSeq identity
-
Classification
- RNA helicases
- Caspase recruitment domain containing
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data