Rabbit IFI44L antibody
-
Catalog number70R-1290
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB, IHC
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenIFI44L antibody was raised using the N terminal of IFI44L corresponding to a region with amino acids MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT
-
SpecificityIFI44L antibody was raised against the N terminal of IFI44L
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of IFI44L antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolIFI44L
-
Short nameRabbit IFI44L antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal IFI44L antibody raised against the N terminal of IFI44L
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetinterferon-induced protein 44-like, C1orf29, IFI44L and IDBG-99874 and ENSG00000137959 and 10964, Cytoplasm, H28 and IDBG-199854 and ENSMUSG00000039146 and 15061, IFI44L and IDBG-637564 and ENSBTAG00000030932 and 508347,782879
-
Gene info
-
Identity
-
Gene
-
Long gene nameinterferon induced protein 44 like
-
Synonyms gene
-
Synonyms gene name
- chromosome 1 open reading frame 29
- interferon-induced protein 44-like
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2002-01-29
-
Entrez gene record
-
RefSeq identity
-
Classification
- TLDc domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data