Rabbit IFI35 antibody

• Catalog number
  70R-1979
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Immunology
• Immunogen
  IFI35 antibody was raised using the N terminal of IFI35 corresponding to a region with amino acids MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPL
• Specificity
  IFI35 antibody was raised against the N terminal of IFI35
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IFI35 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  IFI35  
• Gene symbol
  IFI35
• Short name
  Rabbit IFI35 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal IFI35 antibody raised against the N terminal of IFI35
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  interferon-induced protein 35, IFP35, IFI35 and IDBG-52075 and ENSG00000068079 and 3430, protein binding, nuclei, Ifi35 and IDBG-212192 and ENSMUSG00000010358 and 70110, IFI35 and IDBG-640619 and ENSBTAG00000007389 and 510697

Gene info

• Identity
  HGNC:5399
• Gene
  IFI35
• Long gene name
  interferon induced protein 35
• Synonyms gene name
  • interferon-induced protein 35
• Synonyms
  • IFP35
• GenBank acession
  • BC001356
• Locus
  17q21.31
• Discovery year
  1996-04-12
• Entrez gene record
  3430
• RefSeq identity
  • NM_005533
• VEGA ID
  OTTHUMG00000167720

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products